Structure of PDB 2mbz Chain A Binding Site BS01

Receptor Information
>2mbz Chain A (length=143) Species: 1916 (Streptomyces lividans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GINLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDW
QRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGYE
MHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mbz Structural basis and dynamics of multidrug recognition in a minimal bacterial multidrug resistance system.
ResolutionN/A
Binding residue
(original residue number in PDB)
F126 V135 W139 T142 A144 Y145 S148 I200 H204 C214 L215 M218 Y219 R224 F225 N228 I229
Binding residue
(residue number reindexed from 1)
F16 V25 W29 T32 A34 Y35 S38 I90 H94 C104 L105 M108 Y109 R114 F115 N118 I119
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2mbz, PDBe:2mbz, PDBj:2mbz
PDBsum2mbz
PubMed25489067
UniProtP0A4T9|TIPA_STRLI HTH-type transcriptional activator TipA (Gene Name=tipA)

[Back to BioLiP]