Structure of PDB 2m8s Chain A Binding Site BS01

Receptor Information
>2m8s Chain A (length=97) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKTEEMVQTEEMETPRLSVIVTHSNERYDLLVTPQQGNSEPVVQDLAQL
VEEATGVPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSN
Ligand information
>2m8s Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RYHRRGGYDVENEEKVKLGMTNSH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2m8s Nuclear Magnetic Resonance Structure of the Cytoplasmic Tail of Heparin Binding EGF-like Growth Factor (proHB-EGF-CT) Complexed with the Ubiquitin Homology Domain of Bcl-2-Associated Athanogene 1 from Mus musculus (mBAG-1-UBH).
ResolutionN/A
Binding residue
(original residue number in PDB)		S25 N26 E27 Y29 E94
Binding residue
(residue number reindexed from 1)		S25 N26 E27 Y29 E94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051087 protein-folding chaperone binding

View graph for
Molecular Function
External links
PDB RCSB:2m8s, PDBe:2m8s, PDBj:2m8s
PDBsum2m8s
PubMed24628338
UniProtQ60739|BAG1_MOUSE BAG family molecular chaperone regulator 1 (Gene Name=Bag1)

[Back to BioLiP]