Structure of PDB 2m3m Chain A Binding Site BS01

Receptor Information
>2m3m Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQI
GDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHH
Ligand information
>2m3m Chain B (length=11) Species: 10595 (human papillomavirus 51) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QRTRQRNETQV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2m3m Structural insights into a wildtype domain of the oncoprotein E6 and its interaction with a PDZ domain.
ResolutionN/A
Binding residue
(original residue number in PDB)		G328 L329 F331 S332 I333 A334 G338 N339 K352 I354 H384 E385 V388 L391 K392
Binding residue
(residue number reindexed from 1)		G11 L12 F14 S15 I16 A17 G21 N22 K35 I37 H67 E68 V71 L74 K75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2m3m, PDBe:2m3m, PDBj:2m3m
PDBsum2m3m
PubMed23638119
UniProtQ12959|DLG1_HUMAN Disks large homolog 1 (Gene Name=DLG1)

[Back to BioLiP]