Structure of PDB 2m14 Chain A Binding Site BS01

Receptor Information
>2m14 Chain A (length=115) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQA
TPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNI
KMTLQQIISRYKDAD
Ligand information
>2m14 Chain B (length=15) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YDSEEFEDVTDGNEV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2m14 Structural and functional evidence that Rad4 competes with Rad2 for binding to the Tfb1 subunit of TFIIH in NER.
ResolutionN/A
Binding residue
(original residue number in PDB)		D46 K47 L48 Q49 T51 P52 K57 M59 R61 Q105 K112
Binding residue
(residue number reindexed from 1)		D46 K47 L48 Q49 T51 P52 K57 M59 R61 Q105 K112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006289 nucleotide-excision repair
GO:0006351 DNA-templated transcription
Cellular Component
GO:0000439 transcription factor TFIIH core complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2m14, PDBe:2m14, PDBj:2m14
PDBsum2m14
PubMed23295669
UniProtP32776|TFB1_YEAST General transcription and DNA repair factor IIH subunit TFB1 (Gene Name=TFB1)

[Back to BioLiP]