Structure of PDB 2m0o Chain A Binding Site BS01

Receptor Information
>2m0o Chain A (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKV
DSAREVCLVQFEDDSQFLVLWKDISPAAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2m0o An H3K36 Methylation-Engaging Tudor Motif of Polycomb-like Proteins Mediates PRC2 Complex Targeting.
ResolutionN/A
Binding residue
(original residue number in PDB)
L38 L45 L46 Y47 L48 F65 E66 D67
Binding residue
(residue number reindexed from 1)
L34 L41 L42 Y43 L44 F61 E62 D63
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2m0o, PDBe:2m0o, PDBj:2m0o
PDBsum2m0o
PubMed23273982
UniProtO43189|PHF1_HUMAN PHD finger protein 1 (Gene Name=PHF1)

[Back to BioLiP]