Structure of PDB 2m04 Chain A Binding Site BS01

Receptor Information
>2m04 Chain A (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVK
QALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNW
GRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGG
WDTFVELYGNNAAAESRKGQERLE
Ligand information
>2m04 Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEQWAREIGAQLRRMADDLNAQYER
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2m04 PUMA binding induces partial unfolding within BCL-xL to disrupt p53 binding and promote apoptosis.
ResolutionN/A
Binding residue
(original residue number in PDB)		F97 L99 R103 A104 D107 L108 S110 Q111 H113 T118 Q121 S122 V126 E129 R132 D133 G134 N136 W137 G138 R139 A142 F146 A199
Binding residue
(residue number reindexed from 1)		F60 L62 R66 A67 D70 L71 S73 Q74 H76 T81 Q84 S85 V89 E92 R95 D96 G97 N99 W100 G101 R102 A105 F109 A162
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2m04, PDBe:2m04, PDBj:2m04
PDBsum2m04
PubMed23340338
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]