Structure of PDB 2lt7 Chain A Binding Site BS01

Receptor Information
>2lt7 Chain A (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKK
YPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKS
VHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lt7 Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
ResolutionN/A
Binding residue
(original residue number in PDB)
R475 K477 R501 Y503 V504 S508 R511 Y536 H540 H543 Q563 Y597
Binding residue
(residue number reindexed from 1)
R4 K6 R30 Y32 V33 S37 R40 Y65 H69 H72 Q92 Y126
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2lt7, PDBe:2lt7, PDBj:2lt7
PDBsum2lt7
PubMed22949637
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]