Structure of PDB 2lsi Chain A Binding Site BS01

Receptor Information
>2lsi Chain A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHMAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKD
LEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lsi Insights into the scaffold mechanism of human Rev1 in translesional synthesis revealed by the structural studies on its polymerase-interacting domain
ResolutionN/A
Binding residue
(original residue number in PDB)		L1159 A1160 D1167 L1171 E1174 W1175 M1183 E1185 D1186 Q1189
Binding residue
(residue number reindexed from 1)		L7 A8 D15 L19 E22 W23 M31 E33 D34 Q37
Enzymatic activity
Enzyme Commision number 2.7.7.-
External links
PDB RCSB:2lsi, PDBe:2lsi, PDBj:2lsi
PDBsum2lsi
PubMed
UniProtQ9UBZ9|REV1_HUMAN DNA repair protein REV1 (Gene Name=REV1)

[Back to BioLiP]