Structure of PDB 2lqp Chain A Binding Site BS01

Receptor Information

>2lqp Chain A (length=71) Species: 9606 (Homo sapiens)

DTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRE
ADIDGDGQVNYEEFVQMMTAK

Ligand information

• Ligand ID: CA
• InChI: InChI=1S/Ca/q+2
• InChIKey: BHPQYMZQTOCNFJ-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Ca++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Ca+2]
• Formula: Ca
• Name: CALCIUM ION
• DrugBank: DB14577
• PDB chain: 2lqp Chain A Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2lqp Structural basis for the regulation of L-type voltage-gated calcium channels: interactions between the N-terminal cytoplasmic domain and Ca(2+)-calmodulin.
• Resolution: N/A
• Binding residue (original residue number in PDB): D93 N97 Y99 I100 S101 E104 Q135
• Binding residue (residue number reindexed from 1): D16 N20 Y22 I23 S24 E27 Q58
• Annotation score: 4

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 15:37:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '2lqp', asym_id = 'A', bs = 'BS01', title = 'Structural basis for the regulation of L-type vo...rminal cytoplasmic domain and Ca(2+)-calmodulin. '

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='2lqp', asym_id='A', bs='BS01', title='Structural basis for the regulation of L-type vo...rminal cytoplasmic domain and Ca(2+)-calmodulin. ')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0005509', uniprot = '', pdbid = '2lqp', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005509', uniprot='', pdbid='2lqp', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>