Structure of PDB 2lp0 Chain A Binding Site BS01

Receptor Information
>2lp0 Chain A (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQ
NRRMKMKKMN
Ligand information
>2lp0 Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NQEFDSEEETVEDSLVEDSE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lp0 Structural basis for homeodomain recognition by the cell-cycle regulator Geminin
ResolutionN/A
Binding residue
(original residue number in PDB)		T17 K20 R21 C22 R59 Q60 I63 M70 K71 K74 M75
Binding residue
(residue number reindexed from 1)		T1 K4 R5 C6 R43 Q44 I47 M54 K55 K58 M59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2lp0, PDBe:2lp0, PDBj:2lp0
PDBsum2lp0
PubMed22615398
UniProtP31274|HXC9_HUMAN Homeobox protein Hox-C9 (Gene Name=HOXC9)

[Back to BioLiP]