Structure of PDB 2lox Chain A Binding Site BS01

Receptor Information
>2lox Chain A (length=115) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQA
TPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNI
KMTLQQIISRYKDAD
Ligand information
>2lox Chain B (length=20) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DLEVLSEELFEDVPTKSQIS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lox Structural and functional characterization of interactions involving the Tfb1 subunit of TFIIH and the NER factor Rad2.
ResolutionN/A
Binding residue
(original residue number in PDB)		L48 Q49 A50 T51 P52 S55 K57 M59 R61 M88 K101 Q105 K112 D113
Binding residue
(residue number reindexed from 1)		L48 Q49 A50 T51 P52 S55 K57 M59 R61 M88 K101 Q105 K112 D113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006289 nucleotide-excision repair
GO:0006351 DNA-templated transcription
Cellular Component
GO:0000439 transcription factor TFIIH core complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2lox, PDBe:2lox, PDBj:2lox
PDBsum2lox
PubMed22373916
UniProtP32776|TFB1_YEAST General transcription and DNA repair factor IIH subunit TFB1 (Gene Name=TFB1)

[Back to BioLiP]