Structure of PDB 2lob Chain A Binding Site BS01

Receptor Information
>2lob Chain A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGD
AILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lob Association of the cystic fibrosis transmembrane regulator with CAL: structural features and molecular dynamics.
ResolutionN/A
Binding residue
(original residue number in PDB)		L41 G42 I43 S44 I45 T46 E50 H51 E59 H61 T89 K90 H91 K92 V95 L98
Binding residue
(residue number reindexed from 1)		L15 G16 I17 S18 I19 T20 E24 H25 E33 H35 T63 K64 H65 K66 V69 L72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005794 Golgi apparatus

View graph for
Cellular Component
External links
PDB RCSB:2lob, PDBe:2lob, PDBj:2lob
PDBsum2lob
PubMed16331976
UniProtQ9HD26|GOPC_HUMAN Golgi-associated PDZ and coiled-coil motif-containing protein (Gene Name=GOPC)

[Back to BioLiP]