Structure of PDB 2lnw Chain A Binding Site BS01

Receptor Information
>2lnw Chain A (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFA
ISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQ
LDTTLKYPYKSRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lnw Identification and structural basis for a novel interaction between Vav2 and Arap3.
ResolutionN/A
Binding residue
(original residue number in PDB)
R698 R700 A708 K718 H719 I720 K721 T732 S755 F756 Q758
Binding residue
(residue number reindexed from 1)
R40 R42 A50 K60 H61 I62 K63 T74 S97 F98 Q100
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2lnw, PDBe:2lnw, PDBj:2lnw
PDBsum2lnw
PubMed22750419
UniProtP52735|VAV2_HUMAN Guanine nucleotide exchange factor VAV2 (Gene Name=VAV2)

[Back to BioLiP]