Structure of PDB 2lkx Chain A Binding Site BS01

Receptor Information
>2lkx Chain A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVW
FKNRRAKWRKREEFIVTD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lkx Solution structure of the K50 class homeodomain PITX2 bound to DNA and implications for mutations that cause Rieger syndrome
ResolutionN/A
Binding residue
(original residue number in PDB)
R3 R5 T6 K50 N51 R52 K55 R59
Binding residue
(residue number reindexed from 1)
R5 R7 T8 K52 N53 R54 K57 R61
Binding affinityPDBbind-CN: Kd=2.6nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2lkx, PDBe:2lkx, PDBj:2lkx
PDBsum2lkx
PubMed15895993
UniProtQ99697|PITX2_HUMAN Pituitary homeobox 2 (Gene Name=PITX2)

[Back to BioLiP]