Structure of PDB 2li8 Chain A Binding Site BS01

Receptor Information
>2li8 Chain A (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVAS
CPLKAQQGPSAQG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2li8 Structural basis of pre-let-7 miRNA recognition by the zinc knuckles of pluripotency factor Lin28.
ResolutionN/A
Binding residue
(original residue number in PDB)		M129 K131 R132 R133 S134 D137 R138 Y140 H148 A149 K150 K159 K160 C161 H162 M170 V171 A172
Binding residue
(residue number reindexed from 1)		M6 K8 R9 R10 S11 D14 R15 Y17 H25 A26 K27 K36 K37 C38 H39 M47 V48 A49
Binding affinityPDBbind-CN: Kd=0.16nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:2li8, PDBe:2li8, PDBj:2li8
PDBsum2li8
PubMed22157959
UniProtQ9H9Z2|LN28A_HUMAN Protein lin-28 homolog A (Gene Name=LIN28A)

[Back to BioLiP]