Structure of PDB 2lgg Chain A Binding Site BS01

Receptor Information
>2lgg Chain A (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDP
PLSSVPSEDEWYCPECRND
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lgg Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
ResolutionN/A
Binding residue
(original residue number in PDB)
D320 V322 N323 C329 R337 P340 Q343 M345 D347 S367 D369 E370 W371
Binding residue
(residue number reindexed from 1)
D10 V12 N13 C19 R27 P30 Q33 M35 D37 S57 D59 E60 W61
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:2lgg, PDBe:2lgg, PDBj:2lgg
PDBsum2lgg
PubMed21808299
UniProtQ96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 (Gene Name=UHRF1)

[Back to BioLiP]