Structure of PDB 2lex Chain A Binding Site BS01

Receptor Information
>2lex Chain A (length=63) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVV
TTYEGKHNHDLPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lex Structural basis for sequence-spscific DNA recognition by an Arabidopsis WRKY transcription factor
ResolutionN/A
Binding residue
(original residue number in PDB)		W414 R415 K416 Q419
Binding residue
(residue number reindexed from 1)		W8 R9 K10 Q13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2lex, PDBe:2lex, PDBj:2lex
PDBsum2lex
PubMed22219184
UniProtQ9XI90|WRKY4_ARATH Probable WRKY transcription factor 4 (Gene Name=WRKY4)

[Back to BioLiP]