Structure of PDB 2lec Chain A Binding Site BS01

Receptor Information
>2lec Chain A (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRY
TKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHH
S
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lec A syn-anti conformational difference allows SRSF2 to recognize guanines and cytosines equally well.
ResolutionN/A
Binding residue
(original residue number in PDB)		G4 R5 P6 K17 D42 Y44 P46 D48 R49 F57 F59 R61 R91 Y92 G93 R94 P95 S98 H99
Binding residue
(residue number reindexed from 1)		G4 R5 P6 K17 D42 Y44 P46 D48 R49 F57 F59 R61 R91 Y92 G93 R94 P95 S98 H99
Binding affinityPDBbind-CN: Kd=0.22uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2lec, PDBe:2lec, PDBj:2lec
PDBsum2lec
PubMed22002536
UniProtQ01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 (Gene Name=SRSF2)

[Back to BioLiP]