Structure of PDB 2ld5 Chain A Binding Site BS01

Receptor Information
>2ld5 Chain A (length=67) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQ
NRRVKEKKVINKLKTTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ld5 Structural basis for sequence specific DNA binding and protein dimerization of HOXA13.
ResolutionN/A
Binding residue
(original residue number in PDB)		K9 K10 R11 V12 K30 F31 Q56 R59 V60 K63
Binding residue
(residue number reindexed from 1)		K3 K4 R5 V6 K24 F25 Q50 R53 V54 K57
Binding affinityPDBbind-CN: Kd=7.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ld5, PDBe:2ld5, PDBj:2ld5
PDBsum2ld5
PubMed21829694
UniProtQ62424|HXA13_MOUSE Homeobox protein Hox-A13 (Gene Name=Hoxa13)

[Back to BioLiP]