Structure of PDB 2lct Chain A Binding Site BS01

Receptor Information
>2lct Chain A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHMQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIK
YNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTT
LQFPFKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lct Two closely spaced tyrosines regulate NFAT signaling in B cells via Syk association with Vav.
ResolutionN/A
Binding residue
(original residue number in PDB)		R678 R696 R698 A706 K716 H717 K719 T730 K732 F754 K755 S756 L757
Binding residue
(residue number reindexed from 1)		R18 R36 R38 A46 K56 H57 K59 T70 K72 F94 K95 S96 L97
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2lct, PDBe:2lct, PDBj:2lct
PDBsum2lct
PubMed21606197
UniProtP15498|VAV_HUMAN Proto-oncogene vav (Gene Name=VAV1)

[Back to BioLiP]