Structure of PDB 2lcs Chain A Binding Site BS01

Receptor Information
>2lcs Chain A (length=67) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAIVNQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSK
TGLVPEEFVSYIQPELE
Ligand information
>2lcs Chain B (length=16) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKFIPSRPAPKPPSSA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lcs Distinct Peptide Binding Specificities of Src Homology 3 (SH3) Protein Domains Can Be Determined by Modulation of Local Energetics across the Binding Interface.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y8 F10 E13 N16 W36 V38 T47 G48 L49 E53 F54
Binding residue
(residue number reindexed from 1)		Y12 F14 E17 N20 W40 V42 T51 G52 L53 E57 F58
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2lcs, PDBe:2lcs, PDBj:2lcs
PDBsum2lcs
PubMed22277653
UniProtQ12163|NBP2_YEAST NAP1-binding protein 2 (Gene Name=NBP2)

[Back to BioLiP]