Structure of PDB 2lb3 Chain A Binding Site BS01

Receptor Information
>2lb3 Chain A (length=36) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lb3 A Smad action turnover switch operated by WW domain readers of a phosphoserine code.
ResolutionN/A
Binding residue
(original residue number in PDB)
R18 S20 R21 S22 Y27 F29 W38
Binding residue
(residue number reindexed from 1)
R9 S11 R12 S13 Y18 F20 W29
Enzymatic activity
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
External links
PDB RCSB:2lb3, PDBe:2lb3, PDBj:2lb3
PDBsum2lb3
PubMed21685363
UniProtQ13526|PIN1_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (Gene Name=PIN1)

[Back to BioLiP]