Structure of PDB 2lb2 Chain A Binding Site BS01

Receptor Information
>2lb2 Chain A (length=35) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lb2 A Smad action turnover switch operated by WW domain readers of a phosphoserine code.
ResolutionN/A
Binding residue
(original residue number in PDB)
E372 E373 R374 K378 R380 Y382 V384 N385 H386 R389 T390 T391 W393
Binding residue
(residue number reindexed from 1)
E7 E8 R9 K13 R15 Y17 V19 N20 H21 R24 T25 T26 W28
Enzymatic activity
Enzyme Commision number 2.3.2.26: HECT-type E3 ubiquitin transferase.
2.3.2.36: RING-type E3 ubiquitin transferase (cysteine targeting).
External links
PDB RCSB:2lb2, PDBe:2lb2, PDBj:2lb2
PDBsum2lb2
PubMed21685363
UniProtQ96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like (Gene Name=NEDD4L)

[Back to BioLiP]