Structure of PDB 2lb1 Chain A Binding Site BS01

Receptor Information

>2lb1 Chain A (length=35) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRL

Ligand information

>2lb1 Chain B (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DTPPPAYLPPEDP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2lb1 A Smad action turnover switch operated by WW domain readers of a phosphoserine code.
Resolution	N/A
Binding residue (original residue number in PDB)	E287 V288 R289 S290 R295 Y297 V299 H301 R304 T306 F308
Binding residue (residue number reindexed from 1)	E9 V10 R11 S12 R17 Y19 V21 H23 R26 T28 F30

Enzymatic activity

Enzyme Commision number

2.3.2.26: HECT-type E3 ubiquitin transferase.

External links

PDB	RCSB:2lb1, PDBe:2lb1, PDBj:2lb1
PDBsum	2lb1
PubMed	21685363
UniProt	Q9HCE7\|SMUF1_HUMAN E3 ubiquitin-protein ligase SMURF1 (Gene Name=SMURF1)

[Back to BioLiP]