Structure of PDB 2l75 Chain A Binding Site BS01

Receptor Information
>2l75 Chain A (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTC
PALKGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2l75 Plant Homeodomain (PHD) Fingers of CHD4 Are Histone H3-binding Modules with Preference for Unmodified H3K4 and Methylated H3K9
ResolutionN/A
Binding residue
(original residue number in PDB)		D87 H89 M90 E91 K97 D98 G99 G100 E101 L102 L103 C104 I124 P125 G127
Binding residue
(residue number reindexed from 1)		D1 H3 M4 E5 K11 D12 G13 G14 E15 L16 L17 C18 I38 P39 G41
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
External links
PDB RCSB:2l75, PDBe:2l75, PDBj:2l75
PDBsum2l75
PubMed21278251
UniProtQ14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 (Gene Name=CHD4)

[Back to BioLiP]