Structure of PDB 2l6j Chain A Binding Site BS01

Receptor Information
>2l6j Chain A (length=111) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIK
LGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVE
VDELPEGYDRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2l6j Structure of minimal tetratricopeptide repeat domain protein Tah1 reveals mechanism of its interaction with Pih1 and Hsp90.
ResolutionN/A
Binding residue
(original residue number in PDB)		K8 N12 S42 N43 M46 K50 S78 K79 Y82 R83
Binding residue
(residue number reindexed from 1)		K8 N12 S42 N43 M46 K50 S78 K79 Y82 R83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0051087 protein-folding chaperone binding
Biological Process
GO:0000492 box C/D snoRNP assembly
GO:0006457 protein folding
GO:0050821 protein stabilization
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0097255 R2TP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2l6j, PDBe:2l6j, PDBj:2l6j
PDBsum2l6j
PubMed22179618
UniProtP25638|TAH1_YEAST TPR repeat-containing protein associated with Hsp90 (Gene Name=TAH1)

[Back to BioLiP]