Structure of PDB 2l4t Chain A Binding Site BS01

Receptor Information
>2l4t Chain A (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDK
TDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKR
SEEVVRLLVTRQSLQKAVQQSMLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2l4t Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of glutaminase interacting protein with glutaminase L.
ResolutionN/A
Binding residue
(original residue number in PDB)		I28 L29 G30 F31 S32 I33 G35 G36 I37 Q39 D40 P41 Q43 N44 E48 K53 H90 R94 T98
Binding residue
(residue number reindexed from 1)		I28 L29 G30 F31 S32 I33 G35 G36 I37 Q39 D40 P41 Q43 N44 E48 K53 H90 R94 T98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008013 beta-catenin binding
Biological Process
GO:0007266 Rho protein signal transduction
GO:0008285 negative regulation of cell population proliferation
GO:0016055 Wnt signaling pathway
GO:0030178 negative regulation of Wnt signaling pathway
GO:0090630 activation of GTPase activity
GO:2000009 negative regulation of protein localization to cell surface
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0015629 actin cytoskeleton
GO:0043231 intracellular membrane-bounded organelle
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2l4t, PDBe:2l4t, PDBj:2l4t
PDBsum2l4t
PubMed21417405
UniProtO14907|TX1B3_HUMAN Tax1-binding protein 3 (Gene Name=TAX1BP3)

[Back to BioLiP]