Structure of PDB 2l4k Chain A Binding Site BS01

Receptor Information
>2l4k Chain A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPASGTSLSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQR
NPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFH
QLNRGILPCLLRHCCTRVAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2l4k Water-Refined Solution Structure of the Human Grb7-SH2 Domain in Complex with the erbB2 Receptor Peptide pY1139.
ResolutionN/A
Binding residue
(original residue number in PDB)
S25 R26 E27 Q30 R46 S48 N51 V56 K66 H67 Y68 L69 I70 S82 M83
Binding residue
(residue number reindexed from 1)
S25 R26 E27 Q30 R46 S48 N51 V56 K66 H67 Y68 L69 I70 S82 M83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2l4k, PDBe:2l4k, PDBj:2l4k
PDBsum2l4k
PubMed22702899
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]