Structure of PDB 2l41 Chain A Binding Site BS01

Receptor Information
>2l41 Chain A (length=77) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKSRLFIGNLPLKNVSKEDLFRIFSPYGHIMQINIKNAFGFIQFDNPQSV
RDAIECESQEMNFGKKLILEVSSSNAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2l41 Recognition of transcription termination signal by the nuclear polyadenylated RNA-binding (NAB) 3 protein
ResolutionN/A
Binding residue
(original residue number in PDB)		R4 F6 N9 N34 K36 N37 F41 I68 E70 S72
Binding residue
(residue number reindexed from 1)		R4 F6 N9 N34 K36 N37 F41 I68 E70 S72
Binding affinityPDBbind-CN: Kd=763uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2l41, PDBe:2l41, PDBj:2l41
PDBsum2l41
PubMed21084293
UniProtP38996|NAB3_YEAST Nuclear polyadenylated RNA-binding protein 3 (Gene Name=NAB3)

[Back to BioLiP]