Structure of PDB 2l1c Chain A Binding Site BS01

Receptor Information
>2l1c Chain A (length=191) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSM
RALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLK
FAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAY
VAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
Ligand information
>2l1c Chain B (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RAKWDTANNPLYKEATSTFTNITYRGT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2l1c Integrin {beta}3 phosphorylation dictates its complex with the Shc phosphotyrosine-binding (PTB) domain.
ResolutionN/A
Binding residue
(original residue number in PDB)		S65 M66 R67 N72 T75 Q76 T78 R79 L84 R98 R99 K100 R104 L106 S107 M147 Q148 I150 S151 F152 A153 S154 G155 T160 K169 R175 F198 F202 L206 R207
Binding residue
(residue number reindexed from 1)		S49 M50 R51 N56 T59 Q60 T62 R63 L68 R82 R83 K84 R88 L90 S91 M131 Q132 I134 S135 F136 A137 S138 G139 T144 K153 R159 F182 F186 L190 R191
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0035556 intracellular signal transduction

View graph for
Biological Process
External links
PDB RCSB:2l1c, PDBe:2l1c, PDBj:2l1c
PDBsum2l1c
PubMed20739287
UniProtP29353|SHC1_HUMAN SHC-transforming protein 1 (Gene Name=SHC1)

[Back to BioLiP]