Structure of PDB 2l1b Chain A Binding Site BS01

Receptor Information
>2l1b Chain A (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMA
YEEKEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2l1b Recognition and specificity determinants of the human cbx chromodomains.
ResolutionN/A
Binding residue
(original residue number in PDB)		E2 Q3 V4 F5 V7 W26 W29 Y33 T35 E37 H41 I42 L43 D44 L47
Binding residue
(residue number reindexed from 1)		E2 Q3 V4 F5 V7 W26 W29 Y33 T35 E37 H41 I42 L43 D44 L47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:2l1b, PDBe:2l1b, PDBj:2l1b
PDBsum2l1b
PubMed21047797
UniProtO95931|CBX7_HUMAN Chromobox protein homolog 7 (Gene Name=CBX7)

[Back to BioLiP]