Structure of PDB 2l11 Chain A Binding Site BS01

Receptor Information
>2l11 Chain A (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFL
NSQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2l11 Recognition and specificity determinants of the human cbx chromodomains.
ResolutionN/A
Binding residue
(original residue number in PDB)		E2 F3 V4 V5 W24 F27 D31 T33 E35 N39 D41 C42 E44 L45
Binding residue
(residue number reindexed from 1)		E2 F3 V4 V5 W24 F27 D31 T33 E35 N39 D41 C42 E44 L45
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2l11, PDBe:2l11, PDBj:2l11
PDBsum2l11
PubMed21047797
UniProtQ13185|CBX3_HUMAN Chromobox protein homolog 3 (Gene Name=CBX3)

[Back to BioLiP]