Structure of PDB 2kym Chain A Binding Site BS01

Receptor Information
>2kym Chain A (length=120) Species: 379508 (Lodderomyces elongisporus NRRL YB-4239) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAPLFAVTLYEFKAERDDELDVSPGENLSICAHYDYEWFIAKPINRLGGP
GLVPVSYVRIIDLMDPAKYASVDTYDREQVMKIIDEFKIPTVEQWKDQTR
RYKESSIQIGNGHGQSQGLE
Ligand information
>2kym Chain B (length=16) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKFIPSRPAPKPPSSA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kym Structural and functional characterization of an unusual SH3 domain from the fungal scaffold protein, Bem1p
ResolutionN/A
Binding residue
(original residue number in PDB)		Y8 D16 Y32 W36 G48 L49 S53 Y72 V89 K93
Binding residue
(residue number reindexed from 1)		Y10 D18 Y34 W38 G51 L52 S56 Y75 V92 K96
Enzymatic activity
Enzyme Commision number ?
External links