Structure of PDB 2kxq Chain A Binding Site BS01

Receptor Information
>2kxq Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGGSPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINC
EELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN
Ligand information
>2kxq Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPLGSELESPPPPYSRYPMD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kxq Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity.
ResolutionN/A
Binding residue
(original residue number in PDB)		Q264 G265 Q266 W279 R306 T308 Y314 V316 H318 R321 T322 T323 F325
Binding residue
(residue number reindexed from 1)		Q21 G22 Q23 W36 R63 T65 Y71 V73 H75 R78 T79 T80 F82
Enzymatic activity
Enzyme Commision number 2.3.2.26: HECT-type E3 ubiquitin transferase.
External links
PDB RCSB:2kxq, PDBe:2kxq, PDBj:2kxq
PDBsum2kxq
PubMed20937913
UniProtQ9HAU4|SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 (Gene Name=SMURF2)

[Back to BioLiP]