Structure of PDB 2kwn Chain A Binding Site BS01

Receptor Information
>2kwn Chain A (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKT
YKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSW
SCHLCWELLKEKAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kwn Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
ResolutionN/A
Binding residue
(original residue number in PDB)
D263 F264 L296 Q297 F298 I314 S325 D328 F333 D335 D338 G356
Binding residue
(residue number reindexed from 1)
D5 F6 L38 Q39 F40 I56 S67 D70 F75 D77 D80 G98
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2kwn, PDBe:2kwn, PDBj:2kwn
PDBsum2kwn
PubMed20613843
UniProtQ92784|DPF3_HUMAN Zinc finger protein DPF3 (Gene Name=DPF3)

[Back to BioLiP]