Structure of PDB 2kwf Chain A Binding Site BS01

Receptor Information
>2kwf Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKV
EGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kwf The structure of E-protein activation domain 1 bound to the KIX domain of CBP/p300 elucidates leukemia induction by E2A-PBX1
ResolutionN/A
Binding residue
(original residue number in PDB)		I26 T29 D37 R39 N42 Y46 L79 K82 R86
Binding residue
(residue number reindexed from 1)		I26 T29 D37 R39 N42 Y46 L79 K82 R86
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
GO:0004402 histone acetyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2kwf, PDBe:2kwf, PDBj:2kwf
PDBsum2kwf
PubMed
UniProtQ92793|CBP_HUMAN CREB-binding protein (Gene Name=CREBBP)

[Back to BioLiP]