Structure of PDB 2ksp Chain A Binding Site BS01

Receptor Information
>2ksp Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNT
VLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS
KRRHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ksp Mechanism for the selective interaction of C-terminal Eps15 homology domain proteins with specific Asn-Pro-Phe-containing partners.
ResolutionN/A
Binding residue
(original residue number in PDB)		K73 M76 L86 G87 W90 K91 K97
Binding residue
(residue number reindexed from 1)		K39 M42 L52 G53 W56 K57 K63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:2ksp, PDBe:2ksp, PDBj:2ksp
PDBsum2ksp
PubMed20106972
UniProtQ9H4M9|EHD1_HUMAN EH domain-containing protein 1 (Gene Name=EHD1)

[Back to BioLiP]