Structure of PDB 2ksb Chain A Binding Site BS01

Receptor Information

>2ksb Chain A (length=363) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNV
VVMWIILAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYG
LFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVI
CVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVT
VLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMI
VVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMYN
PIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKV
SRLETTISTVVGA

Ligand information

>2ksb Chain B (length=11) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RPKPQQFFGLM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ksb NMR evidence of GM1-induced conformational change of Substance P using isotropic bicelles
Resolution	N/A
Binding residue (original residue number in PDB)	L5 P13 I15 S16 T17 S20 L102 F103
Binding residue (residue number reindexed from 1)	L4 P12 I14 S15 T16 S19 L101 F102

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0004995	tachykinin receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2ksb, PDBe:2ksb, PDBj:2ksb
PDBsum	2ksb
PubMed	20937248
UniProt	P25103\|NK1R_HUMAN Substance-P receptor (Gene Name=TACR1)

[Back to BioLiP]