Structure of PDB 2kpl Chain A Binding Site BS01

Receptor Information
>2kpl Chain A (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSL
VLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLE
LCRGYPLPFDPDDPNTSLVTSVAILDKEP
Ligand information
>2kpl Chain B (length=11) Species: 333760 (Human papillomavirus 16) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RSSRTRRETQV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kpl The structural and dynamic response of MAGI-1 PDZ1 with non-canonical domain boundaries to binding of human papillomavirus (HPV) E6
ResolutionN/A
Binding residue
(original residue number in PDB)
F27 G28 F29 T30 V31 V32 G33 D35 E36 D38 E39 Q42 K44 H77 V81 F84 S113 L114 V115
Binding residue
(residue number reindexed from 1)
F31 G32 F33 T34 V35 V36 G37 D39 E40 D42 E43 Q46 K48 H81 V85 F88 S117 L118 V119
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2kpl, PDBe:2kpl, PDBj:2kpl
PDBsum2kpl
PubMed21238461
UniProtQ96QZ7|MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (Gene Name=MAGI1)

[Back to BioLiP]