Structure of PDB 2ko0 Chain A Binding Site BS01

Receptor Information
>2ko0 Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKY
SSICSEHFTPDSFKRESNNKLLKENAVPTIFLELVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ko0 Structural determinants of specific DNA-recognition by the THAP zinc finger
ResolutionN/A
Binding residue
(original residue number in PDB)
M1 V2 Q3 Y14 F22 H23 K24 T28 K64 R65 L71
Binding residue
(residue number reindexed from 1)
M1 V2 Q3 Y14 F22 H23 K24 T28 K64 R65 L71
Binding affinityPDBbind-CN: Kd=480nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0043565 sequence-specific DNA binding

View graph for
Molecular Function
External links
PDB RCSB:2ko0, PDBe:2ko0, PDBj:2ko0
PDBsum2ko0
PubMed20144952
UniProtQ9NVV9|THAP1_HUMAN THAP domain-containing protein 1 (Gene Name=THAP1)

[Back to BioLiP]