Structure of PDB 2knh Chain A Binding Site BS01

Receptor Information
>2knh Chain A (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGSGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIE
EFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQ
HEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2knh Structure of the AML1-ETO eTAFH domain-HEB peptide complex and its contribution to AML1-ETO activity.
ResolutionN/A
Binding residue
(original residue number in PDB)		R276 F277 T280 F284 L325 R326 F328 V329 F332
Binding residue
(residue number reindexed from 1)		R15 F16 T19 F23 L64 R65 F67 V68 F71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2knh, PDBe:2knh, PDBj:2knh
PDBsum2knh
PubMed19204326
UniProtQ06455|MTG8_HUMAN Protein CBFA2T1 (Gene Name=RUNX1T1)

[Back to BioLiP]