Structure of PDB 2kn7 Chain A Binding Site BS01

Receptor Information

>2kn7 Chain A (length=67) Species: 9606 (Homo sapiens)

EKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNA
ANAKQLYDFIHTSFAEV

Ligand information

>2kn7 Chain B (length=10)

cagtggctga

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2kn7 The structure of the XPF-ssDNA complex underscores the distinct roles of the XPF and ERCC1 helix- hairpin-helix domains in ss/ds DNA recognition
• Resolution: N/A
• Binding residue (original residue number in PDB): K29 R32 S33 H36 H37 V38 K39 I55 N58
• Binding residue (residue number reindexed from 1): K20 R23 S24 H27 H28 V29 K30 I46 N49

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

External links

• PDB: RCSB:2kn7, PDBe:2kn7, PDBj:2kn7
• PDBsum: 2kn7
• PubMed: 22483113
• UniProt: Q92889|XPF_HUMAN DNA repair endonuclease XPF (Gene Name=ERCC4)