Structure of PDB 2kmk Chain A Binding Site BS01

Receptor Information
>2kmk Chain A (length=82) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTF
IHTGEKPHKCQVCGKAFSQSSNLITHSRKHTG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kmk Solution structure of Gfi-1 zinc domain bound to consensus DNA.
ResolutionN/A
Binding residue
(original residue number in PDB)		R13 T16 I23 H40 Q41 D44 I51 K65 Q69 K79
Binding residue
(residue number reindexed from 1)		R13 T16 I23 H40 Q41 D44 I51 K65 Q69 K79
Binding affinityPDBbind-CN: Kd=0.26nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2kmk, PDBe:2kmk, PDBj:2kmk
PDBsum2kmk
PubMed20153336
UniProtQ07120|GFI1_RAT Zinc finger protein Gfi-1 (Gene Name=Gfi1)

[Back to BioLiP]