Structure of PDB 2kkf Chain A Binding Site BS01

Receptor Information
>2kkf Chain A (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQN
LQWMPSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kkf Structure of the MLL CXXC domain-DNA complex and its functional role in MLL-AF9 leukemia.
ResolutionN/A
Binding residue
(original residue number in PDB)		K1147 R1150 S1152 R1154 N1183 K1186 Q1187 C1188 K1193 L1197
Binding residue
(residue number reindexed from 1)		K1 R4 S6 R8 N37 K40 Q41 C42 K47 L51
Binding affinityPDBbind-CN: Kd=44uM
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:2kkf, PDBe:2kkf, PDBj:2kkf
PDBsum2kkf
PubMed20010842
UniProtQ03164|KMT2A_HUMAN Histone-lysine N-methyltransferase 2A (Gene Name=KMT2A)

[Back to BioLiP]