Structure of PDB 2kid Chain A Binding Site BS01

Receptor Information

>2kid Chain A (length=148) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENE
SLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSI
RDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK

Ligand information

>2kid Chain C (length=5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tLPAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2kid The structure of the Staphylococcus aureus sortase-substrate complex reveals how the universally conserved LPXTG sorting signal is recognized.
Resolution	N/A
Binding residue (original residue number in PDB)	H120 P163 T164 D165 V166 V168 C184 W194 R197
Binding residue (residue number reindexed from 1)	H62 P105 T106 D107 V108 V110 C126 W136 R139

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:2kid, PDBe:2kid, PDBj:2kid
PDBsum	2kid
PubMed	19592495
UniProt	Q9S446

[Back to BioLiP]