Structure of PDB 2kh9 Chain A Binding Site BS01

Receptor Information
>2kh9 Chain A (length=86) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYI
DVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kh9 Structure and functional implications of a complex containing a segment of U6 RNA bound by a domain of Prp24.
ResolutionN/A
Binding residue
(original residue number in PDB)		T118 W120 T122 R148 L149 P150 R153 R158 Y162 K191 N194
Binding residue
(residue number reindexed from 1)		T5 W7 T9 R35 L36 P37 R40 R45 Y49 K78 N81
Binding affinityPDBbind-CN: Kd=90uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2kh9, PDBe:2kh9, PDBj:2kh9
PDBsum2kh9
PubMed20181740
UniProtP49960|PRP24_YEAST U4/U6 snRNA-associated-splicing factor PRP24 (Gene Name=PRP24)

[Back to BioLiP]