Structure of PDB 2kfy Chain A Binding Site BS01

Receptor Information
>2kfy Chain A (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTRE
GRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHS
GP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kfy Structural basis of G-tract recognition and encaging by hnRNP F quasi-RRMs.
ResolutionN/A
Binding residue
(original residue number in PDB)		K14 R16 G17 L18 W20 R52 S54 R75 R81 Y82 E84 V85 F86
Binding residue
(residue number reindexed from 1)		K14 R16 G17 L18 W20 R52 S54 R75 R81 Y82 E84 V85 F86
Binding affinityPDBbind-CN: Kd=0.42uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2kfy, PDBe:2kfy, PDBj:2kfy
PDBsum2kfy
PubMed20526337
UniProtP52597|HNRPF_HUMAN Heterogeneous nuclear ribonucleoprotein F (Gene Name=HNRNPF)

[Back to BioLiP]