Structure of PDB 2kft Chain A Binding Site BS01

Receptor Information
>2kft Chain A (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCL
QATVQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kft Structure and Site-Specific Recognition of Histone H3 by the PHD Finger of Human Autoimmune Regulator.
ResolutionN/A
Binding residue
(original residue number in PDB)		K294 E296 D297 D304 G305 G306 E307 L308 I309 C310 D312 I330 P331 G333 T334
Binding residue
(residue number reindexed from 1)		K3 E5 D6 D13 G14 G15 E16 L17 I18 C19 D21 I39 P40 G42 T43
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2kft, PDBe:2kft, PDBj:2kft
PDBsum2kft
PubMed19446523
UniProtO43918|AIRE_HUMAN Autoimmune regulator (Gene Name=AIRE)

[Back to BioLiP]