Structure of PDB 2kff Chain A Binding Site BS01

Receptor Information
>2kff Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNT
VLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPS
KRRHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kff Structural insight into the interaction of proteins containing NPF, DPF, and GPF motifs with the C-terminal EH-domain of EHD1.
ResolutionN/A
Binding residue
(original residue number in PDB)		K73 M76 N83 G87 W90
Binding residue
(residue number reindexed from 1)		K39 M42 N49 G53 W56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:2kff, PDBe:2kff, PDBj:2kff
PDBsum2kff
PubMed19798736
UniProtQ9H4M9|EHD1_HUMAN EH domain-containing protein 1 (Gene Name=EHD1)

[Back to BioLiP]