Structure of PDB 2kek Chain A Binding Site BS01

Receptor Information
>2kek Chain A (length=62) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN
RCAQQLAGKQSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kek Specificity and affinity of Lac repressor for the auxiliary operators O2 and O3 are explained by the structures of their protein-DNA complexes.
ResolutionN/A
Binding residue
(original residue number in PDB)		S16 Y17 Q18 R22 H29 S31 L56 A57 K59
Binding residue
(residue number reindexed from 1)		S16 Y17 Q18 R22 H29 S31 L56 A57 K59
Binding affinityPDBbind-CN: Kd=100nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2kek, PDBe:2kek, PDBj:2kek
PDBsum2kek
PubMed19450607
UniProtP03023|LACI_ECOLI Lactose operon repressor (Gene Name=lacI)

[Back to BioLiP]